General Information

  • ID:  hor004040
  • Uniprot ID:  A0A977SQV0
  • Protein name:  Pyrokinin-2
  • Gene name:  NA
  • Organism:  Zophobas atratus (Giant mealworm beetle) (Zophobas rugipes)
  • Family:  Pyrokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Zophobas (genus), Tenebrioninae (subfamily), Tenebrionidae (family), Tenebrionoidea (superfamily), Cucujiformia (infraorder), Polyphaga (suborder), Coleoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  GO:0016020 membrane

Sequence Information

  • Sequence:  SPPFAPRL
  • Length:  8
  • Propeptide:  ERVVVVNWVVICVLILLLEYISSVSQNDFHHRHVNNQGNTHGGHIKEPYVWPSPKLGRKKRNSSSNDFYDNLQKEGLAMLIMDALQNGPLSNGNAGKRHVVKFTPRLGRESEEEIVNGIRPDENQWPSDDSAISAEYLYQRSPPFAPRLGRHLPYLPRLRQNDRMPFS
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  The modulation of muscle contractile activity
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004040_AF2.pdbhor004040_ESM.pdb

Physical Information

Mass: 100907 Formula: C42H65N11O10
Absent amino acids: CDEGHIKMNQTVWY Common amino acids: P
pI: 10.55 Basic residues: 1
Polar residues: 1 Hydrophobic residues: 3
Hydrophobicity: -21.25 Boman Index: -861
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 61.25
Instability Index: 12647.5 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  21067424
  • Title:  Identification of Myotropic Neuropeptides From the Brain and Corpus Cardiacum-Corpus Allatum Complex of the Beetle, Zophobas Atratus